PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 227aa    MW: 25849.3 Da    PI: 9.1979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00162genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+  ++++G  +W++ +++ g+ R++k+c++rw++yl
       AA39G00162 14 KGEWTAEEDRKLAAFITEHGFADWRSLPKKAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding56.94.6e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g++T+eE++ +++ +++lG++ W++Ia++++ +Rt++++k++w++ 
       AA39G00162  67 KGKFTPEEEDVIIQFHALLGNR-WASIAKELP-NRTDNDIKNHWNSC 111
                      79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.727961IPR017930Myb domain
SuperFamilySSF466896.83E-2911108IPR009057Homeodomain-like
SMARTSM007176.3E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231568IPR009057Homeodomain-like
CDDcd001675.70E-91661No hitNo description
PROSITE profilePS5129428.08862116IPR017930Myb domain
SMARTSM007179.8E-1766114IPR001005SANT/Myb domain
PfamPF002494.9E-1767111IPR001005SANT/Myb domain
CDDcd001678.92E-1169109No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2669117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRTTWYDVD GKRKGEWTAE EDRKLAAFIT EHGFADWRSL PKKAGLQRCG KSCRLRWLNY  60
LKPGIKKGKF TPEEEDVIIQ FHALLGNRWA SIAKELPNRT DNDIKNHWNS CLKKRLKKSG  120
INPVTHEPMT VKTTTFEESM ASTTLSPSSS SSGSAKILNK LANGLSSRQY DLDRIKNILC  180
SQRVATSELK NDNIDTMETA SFNVPEWDEE KLRGFLEMDT MGWDTTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602606.12e-99PREDICTED: transcription factor MYB34-like isoform X1
RefseqXP_013602607.12e-99PREDICTED: transcription factor MYB34-like isoform X2
SwissprotO643993e-58MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3DWM12e-97A0A0D3DWM1_BRAOL; Uncharacterized protein
STRINGBra016546.1-P6e-94(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-90myb domain protein 47